PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA32G00284
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family HB-other
Protein Properties Length: 951aa    MW: 106258 Da    PI: 7.333
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA32G00284genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox222.8e-0795151157
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                 +r+R  +t++ ++ L+++F  +  ++++e +e++++ g+t +qV+ +F  ++++ +k
  AA32G00284  95 KRPRDLLTPKAVKYLQAVFSIKDAITKKESREISAQFGITVAQVRDYFVTQKTRVRK 151
                 799*********************************************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.59E-788155IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-689142IPR009057Homeodomain-like
PROSITE profilePS5007111.17592152IPR001356Homeobox domain
SMARTSM003895.9E-594156IPR001356Homeobox domain
CDDcd000861.99E-495152No hitNo description
PfamPF000461.0E-495151IPR001356Homeobox domain
SuperFamilySSF476767.85E-5271364IPR017923Transcription factor IIS, N-terminal
Gene3DG3DSA:1.20.930.100.001271361IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 951 aa     Download sequence    Send to blast
MDAFKEEIEI GSSVESLLEL LDSQKDLFHS QIDQLQDVVV TQCNLTGVNP LAQEMVGCPY  60
DIFLVSRAVC FFWVLASYMA QLVSLLDIAS EKERKRPRDL LTPKAVKYLQ AVFSIKDAIT  120
KKESREISAQ FGITVAQVRD YFVTQKTRVR KQVRLSREKA IIFSTPLLQH DGVLENNNAL  180
NPADPVPLNS GPIYTEALSL DPVPLASIVP TSGVDSFGIM SHDDIPPDIS DSDKYFAENI  240
FPLLHKEETF SGQVKLMEWI MQIQDSSVLI WFLLKGGVLI LTTWLSQAAI EEQTSVILLI  300
LKVLCHLPLY KASPENMSAI LQSVNGLRFY RTSDISNRAK GLLSRWTKLF AKIQAMKKQN  360
RNNSHIDAQS QLLLKQRQVP GLYVVIIYFI FPPFFFIADI MGESSNPQED FLSLSNGKSE  420
NIRRVEPSQG PKLLLTSADD STKKHMLDNK ERRKVQMVEQ PGQKPVGRGP QTVRIGTSNR  480
SRPMSADDIQ KAKMRALYMQ SKHGKKEPLP DASSDSKTIV PENPLALQSA KDSPPSQQNE  540
AKSECTDEPS AVQPVNSPAV NVVGQVDESE KPSIAAQHVS SKVGVLVKMS PQAILENCKR  600
NQIIWHAPPE MVLDDLWRVA AGGNSKEIDV QKNRNRRERE TIYHSLQIIP LNPKEPWDKE  660
MDFDDSLTPE IPSQQPPEES VTTQPEDSLD ERRTAAAAAS TSSSQGSNAL EPDLELLAAL  720
LKNPDLVFAL TSGQSGNFAG QDVVKLLDVI KTGGPNSSSS ANKKVEEKVE VSLPSPTPST  780
NPGMSGWGQE AIRNPFSRQV ARTSTTIAER QQQQQQQQQQ AMQPKLRQNQ HFQQHPISTT  840
SYAIREPVGH MGATGPPSVS WRSQQQSQNS YYTHQVNEMS SVRGGGAQAY QVNNNNQQYM  900
SNPGFESWSP DHSPNRNHPN IMRGQPQQPQ QPLRKPDSHQ HPYWSQNKRW R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU034561e-159U03456.1 Arabidopsis thaliana Wassilewskija Luminidependens mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010422575.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLV4KJ890.0V4KJ89_EUTSA; Uncharacterized protein
STRINGscaffold_604015.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein